PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn191681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 408aa    MW: 45091.3 Da    PI: 8.4942
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn191681genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-32254307255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Achn191681 254 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 307
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15251307IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28252307IPR009057Homeodomain-like
TIGRFAMsTIGR015579.9E-24254307IPR006447Myb domain, plants
PfamPF002497.2E-7255306IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MPLEGVFIEP SSNPTPDLSL HICPPNTSSI CNNIGLVDSR FDLLGRHSDS HKSRASTNSI  60
TDLSLTHPAN AVADNGGHPQ SFAQEQTPRN PNHHFLHHYN NASHLNHINH GVSLLDVSSD  120
GLRPIKGIPV YHNRSFPFMP LDQVRDHRDY NPKMPFYQMP YPSLSSPSSS SSSSLLSHSP  180
SSPFLDRMSI LNSCPNGSSS SPYRTFSPRL NGFSPSYQLH HHGYGVGPSN EASHGLMRSR  240
FMPKLPSKRS MRAPRMRWTS TLHARFVHAV ELLGGHERAT PKSVLELMDV KDLTLAHVKS  300
HLQMYRTVKT TDKPAASSGQ SDGSGEEDIS TMGQRGPSDG SLPQETDFPS TTTLWSNSSR  360
MFAFAWYPIA EKMHPHENGL SRVKGYLGSD LDQKNPSLEF TLGRPDW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010648942.11e-141PREDICTED: transcription repressor KAN1 isoform X2
TrEMBLC5DB441e-141C5DB44_VITVI; KANADI like transcription factor
STRINGVIT_04s0043g00340.t011e-141(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-68G2-like family protein